Lineage for d5dzub_ (5dzu B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2053108Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2053846Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 2053956Family b.42.4.0: automated matches [191368] (1 protein)
    not a true family
  6. 2053957Protein automated matches [190445] (6 species)
    not a true protein
  7. 2054009Species Potato (Solanum tuberosum) [TaxId:4113] [226410] (9 PDB entries)
  8. 2054014Domain d5dzub_: 5dzu B: [278358]
    automated match to d3tc2c_
    complexed with edo, gol, nag

Details for d5dzub_

PDB Entry: 5dzu (more details), 2.12 Å

PDB Description: structure of potato cathepsin d inhibitor
PDB Compounds: (B:) Aspartic protease inhibitor 11

SCOPe Domain Sequences for d5dzub_:

Sequence, based on SEQRES records: (download)

>d5dzub_ b.42.4.0 (B:) automated matches {Potato (Solanum tuberosum) [TaxId: 4113]}
splpkpvldtngkelnpnssyriisigrgalggdvylgkspnsdapcpdgvfrynsdvgp
sgtpvrfiplsggifedqllniqfniatvklcvsytiwkvgnlnayfrtmlletggtigq
adssyfkivklsnfgynllycpitppflcpfcrddnfcakvgvviqngkrrlalvnenpl
dvlfqev

Sequence, based on observed residues (ATOM records): (download)

>d5dzub_ b.42.4.0 (B:) automated matches {Potato (Solanum tuberosum) [TaxId: 4113]}
splpkpvldtngkelnpnssyriisigrgalggdvylgkspnsdapcpdgvfrynsdvgp
sgtpvrfiplsggifedqllniqfniatvklcvsytiwkvgnlnayfrtmlletggtigq
adssyfkivklsnfgynllycpidnfcakvgvviqngkrrlalvnenpldvlfqev

SCOPe Domain Coordinates for d5dzub_:

Click to download the PDB-style file with coordinates for d5dzub_.
(The format of our PDB-style files is described here.)

Timeline for d5dzub_: