Lineage for d5dtib_ (5dti B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2474355Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2474356Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2474357Family c.69.1.1: Acetylcholinesterase-like [53475] (6 protein domains)
    automatically mapped to Pfam PF00135
  6. 2474358Protein Acetylcholinesterase [53476] (5 species)
  7. 2474399Species Mouse (Mus musculus) [TaxId:10090] [53479] (30 PDB entries)
  8. 2474419Domain d5dtib_: 5dti B: [278356]
    Other proteins in same PDB: d5dtia2
    automated match to d2whqa_

Details for d5dtib_

PDB Entry: 5dti (more details), 2 Å

PDB Description: crystal structure of mouse acetylcholinesterase
PDB Compounds: (B:) acetylcholinesterase

SCOPe Domain Sequences for d5dtib_:

Sequence, based on SEQRES records: (download)

>d5dtib_ c.69.1.1 (B:) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]}
edpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvldat
tfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiygggf
ysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlalqwv
qeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvsage
arrratllarlvgcppggaggndteliaclrtrpaqdlvdhewhvlpqesifrfsfvpvv
dgdflsdtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqflagv
rigvpqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaaqga
rvyayifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkywtnf
artgdpndprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkll

Sequence, based on observed residues (ATOM records): (download)

>d5dtib_ c.69.1.1 (B:) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]}
edpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvldat
tfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiygggf
ysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlalqwv
qeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvsage
arrratllarlvgcpndteliaclrtrpaqdlvdhewhvlpqesifrfsfvpvvdgdfls
dtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqflagvrigvpq
asdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaaqgarvyayi
fehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkywtnfartgdp
ndprdspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkll

SCOPe Domain Coordinates for d5dtib_:

Click to download the PDB-style file with coordinates for d5dtib_.
(The format of our PDB-style files is described here.)

Timeline for d5dtib_: