Lineage for d5dtga1 (5dtg A:1-540)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2134064Family c.69.1.1: Acetylcholinesterase-like [53475] (6 protein domains)
    automatically mapped to Pfam PF00135
  6. 2134065Protein Acetylcholinesterase [53476] (5 species)
  7. 2134094Species Mouse (Mus musculus) [TaxId:10090] [53479] (29 PDB entries)
  8. 2134131Domain d5dtga1: 5dtg A:1-540 [278354]
    Other proteins in same PDB: d5dtga2
    automated match to d2whqa_

Details for d5dtga1

PDB Entry: 5dtg (more details), 2.4 Å

PDB Description: crystal structure of mouse acetylchoinesterase inhibited by dfp
PDB Compounds: (A:) acetylcholinesterase

SCOPe Domain Sequences for d5dtga1:

Sequence, based on SEQRES records: (download)

>d5dtga1 c.69.1.1 (A:1-540) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]}
egredpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvl
dattfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiyg
ggfysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlal
qwvqeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvs
agearrratllarlvgcppggaggndteliaclrtrpaqdlvdhewhvlpqesifrfsfv
pvvdgdflsdtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqfl
agvrigvpqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaa
qgarvyayifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkyw
tnfartgdpndprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkll

Sequence, based on observed residues (ATOM records): (download)

>d5dtga1 c.69.1.1 (A:1-540) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]}
egredpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvl
dattfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiyg
ggfysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlal
qwvqeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvs
agearrratllarlvgcpndteliaclrtrpaqdlvdhewhvlpqesifrfsfvpvvdgd
flsdtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqflagvrig
vpqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaaqgarvy
ayifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkywtnfart
gdpndprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkll

SCOPe Domain Coordinates for d5dtga1:

Click to download the PDB-style file with coordinates for d5dtga1.
(The format of our PDB-style files is described here.)

Timeline for d5dtga1:

  • d5dtga1 first appeared in SCOPe 2.05, called d5dtga_

View in 3D
Domains from same chain:
(mouse over for more information)
d5dtga2
View in 3D
Domains from other chains:
(mouse over for more information)
d5dtgb_