SCOPe 2.05: Domain d5deqa1: 5deq A:1-149

Lineage for d5deqa1 (5deq A:1-149)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.6: BT0354 N-terminal domain-like [143772] (3 proteins)
   accosiated with the C-terminal "winged helix" domain (46785)

6. Protein automated matches [273866] (1 species)
   not a true protein

7. Species Bacteroides thetaiotaomicron [TaxId:226186] [273867] (3 PDB entries)

8. Domain d5deqa1: 5deq A:1-149 [278347]
   Other proteins in same PDB: d5deqa2, d5deqb2
   automated match to d2fb1a2
   complexed with ara, fmt, so4

Details for d5deqa1

PDB Entry: 5deq, 1.95 Å

PDB Description: crystal structure of transcriptional factor arar from bacteroides thetaiotaomicron vpi in complex with l-arabinose

PDB Compounds: (A:) transcriptional regulator AraR

SCOPe Domain Sequences for d5deqa1:

Sequence; same for both SEQRES and ATOM records:

>d5deqa1 d.113.1.6 (A:1-149) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
mknyyssnptfylgidciifgfnegeisllllkrnfepamgewslmggfvqkdesvddaa
krvlaeltglenvymeqvgafgaidrdpgervvsiayyalinineydrelvqkhnaywvn
inelpalifdhpemvdkaremmkqkasve

Timeline for d5deqa1:

• d5deqa1 is new in SCOPe 2.05-stable
  
• d5deqa1 appears in SCOPe 2.06
  
• d5deqa1 appears in the current release, SCOPe 2.08