![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
![]() | Superfamily d.113.1: Nudix [55811] (8 families) ![]() |
![]() | Family d.113.1.6: BT0354 N-terminal domain-like [143772] (2 proteins) accosiated with the C-terminal "winged helix" domain (46785) |
![]() | Protein Hypothetical protein BT0354, N-terminal domain [143775] (1 species) |
![]() | Species Bacteroides thetaiotaomicron [TaxId:818] [143776] (3 PDB entries) Uniprot Q8AAV8 3-149 |
![]() | Domain d5deqa1: 5deq A:1-149 [278347] Other proteins in same PDB: d5deqa2, d5deqb2 automated match to d2fb1a2 complexed with ara, fmt, so4 |
PDB Entry: 5deq (more details), 1.95 Å
SCOPe Domain Sequences for d5deqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5deqa1 d.113.1.6 (A:1-149) Hypothetical protein BT0354, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} mknyyssnptfylgidciifgfnegeisllllkrnfepamgewslmggfvqkdesvddaa krvlaeltglenvymeqvgafgaidrdpgervvsiayyalinineydrelvqkhnaywvn inelpalifdhpemvdkaremmkqkasve
Timeline for d5deqa1: