Lineage for d5c6kb_ (5c6k B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2605773Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily)
    core: alpha3-beta3-alpha4; one side of beta-sheet is exposed
  4. 2605774Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families) (S)
  5. 2605775Family d.163.1.1: Lambda integrase-like, catalytic core [56350] (6 proteins)
  6. 2605846Protein Integrase (Int) [56353] (2 species)
  7. 2605860Species Enterobacteria phage [TaxId:10679] [311112] (2 PDB entries)
  8. 2605862Domain d5c6kb_: 5c6k B: [278335]
    automated match to d1aihb_

Details for d5c6kb_

PDB Entry: 5c6k (more details), 1.9 Å

PDB Description: bacteriophage p2 integrase catalytic domain
PDB Compounds: (B:) integrase

SCOPe Domain Sequences for d5c6kb_:

Sequence, based on SEQRES records: (download)

>d5c6kb_ d.163.1.1 (B:) Integrase (Int) {Enterobacteria phage [TaxId: 10679]}
gyltqeeialllaaldgdnkkiailclstgarwgeaarlkaeniihnrvtfvktktnkpr
tvpiseavakmiadnkrgflfpdadyprfrrtmkaikpdlpmgqathalrhsfathfmin
ggsiitlqrilghtrieqtmvyahfapeylqdaislnplrggteaesv

Sequence, based on observed residues (ATOM records): (download)

>d5c6kb_ d.163.1.1 (B:) Integrase (Int) {Enterobacteria phage [TaxId: 10679]}
gyltqeeialllaaldgdnkkiailclstgarwgeaarlkaeniihnrvtfvkttnkprt
vpiseavakmiadnkrgflfpdadyprfrrtmkaikpdlpmgqathalrhsfathfming
gsiitlqrilghtrieqtmvyahfapeylqdaislnplrggteaesv

SCOPe Domain Coordinates for d5c6kb_:

Click to download the PDB-style file with coordinates for d5c6kb_.
(The format of our PDB-style files is described here.)

Timeline for d5c6kb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5c6ka_