SCOPe 2.05: Domain d5c3qa_: 5c3q A:

Lineage for d5c3qa_ (5c3q A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.0: automated matches [191672] (1 protein)
   not a true family

6. Protein automated matches [191281] (9 species)
   not a true protein

7. Species Neurospora crassa [TaxId:5141] [278316] (4 PDB entries)

8. Domain d5c3qa_: 5c3q A: [278329]
   automated match to d1odna_
   complexed with akg, edo, ni, tdr

Details for d5c3qa_

PDB Entry: 5c3q, 2.05 Å

PDB Description: crystal structure of the full-length neurospora crassa t7h in complex with alpha-kg and thymine (t)

PDB Compounds: (A:) Thymine dioxygenase

SCOPe Domain Sequences for d5c3qa_:

Sequence; same for both SEQRES and ATOM records:

>d5c3qa_ b.82.2.0 (A:) automated matches {Neurospora crassa [TaxId: 5141]}
gsmekaavnedglviplidfskflegdetlkletakailhgfqtagfiylknipiqpdfr
ehvfntsakffklpkekklevgwttpeanrgysapgrekvtqltdpaeiekirsaapdik
esyeigredepghpnpwpaeqddlvgfkstmnnffdqckalhievmraiavgmgidanyf
dsfvdvgdnilrllhypavksevfkinpgqvragehtdygsitllfqdsrgglqvkspng
qfidatpientvvvnagdllarwsndtikstvhrvveppkqedvhpprysiayfcnpnhk
syieaipgtyaaeserkyeginsgkylvqrlaaty

Timeline for d5c3qa_:

• d5c3qa_ is new in SCOPe 2.05-stable
  
• d5c3qa_ is called d5c3qa1 in SCOPe 2.06
  
• d5c3qa_ appears in the current release, SCOPe 2.08, called d5c3qa1