Lineage for d5c3pb1 (5c3p B:1-331)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2070786Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2071232Family b.82.2.0: automated matches [191672] (1 protein)
    not a true family
  6. 2071233Protein automated matches [191281] (13 species)
    not a true protein
  7. 2071237Species Fungus (Neurospora crassa) [TaxId:5141] [278316] (4 PDB entries)
  8. 2071243Domain d5c3pb1: 5c3p B:1-331 [278320]
    Other proteins in same PDB: d5c3pb2
    automated match to d1odna_
    complexed with akg, edo, ni

Details for d5c3pb1

PDB Entry: 5c3p (more details), 2.1 Å

PDB Description: crystal structure of the full-length neurospora crassa t7h in complex with alpha-kg
PDB Compounds: (B:) Thymine dioxygenase

SCOPe Domain Sequences for d5c3pb1:

Sequence, based on SEQRES records: (download)

>d5c3pb1 b.82.2.0 (B:1-331) automated matches {Fungus (Neurospora crassa) [TaxId: 5141]}
mekaavnedglviplidfskflegdetlkletakailhgfqtagfiylknipiqpdfreh
vfntsakffklpkekklevgwttpeanrgysapgrekvtqltdpaeiekirsaapdikes
yeigredepghpnpwpaeqddlvgfkstmnnffdqckalhievmraiavgmgidanyfds
fvdvgdnilrllhypavksevfkinpgqvragehtdygsitllfqdsrgglqvkspngqf
idatpientvvvnagdllarwsndtikstvhrvveppkqedvhpprysiayfcnpnhksy
ieaipgtyaaeserkyeginsgkylvqrlaa

Sequence, based on observed residues (ATOM records): (download)

>d5c3pb1 b.82.2.0 (B:1-331) automated matches {Fungus (Neurospora crassa) [TaxId: 5141]}
mekaavnedglviplidfskflegdetlkletakailhgfqtagfiylknipiqpdfreh
vfntsakffklpkekklevgwttpeanrgysapgrekvtiekirsaapdikesyeigred
epghpnpwpaeqddlvgfkstmnnffdqckalhievmraiavgmgidanyfdsfvdvgdn
ilrllhypavksevfkinpgqvragehtdygsitllfqdsrgglqvkspngqfidatpie
ntvvvnagdllarwsndtikstvhrvveppkqedvhpprysiayfcnpnhksyieaipgt
yaaeserkyeginsgkylvqrlaa

SCOPe Domain Coordinates for d5c3pb1:

Click to download the PDB-style file with coordinates for d5c3pb1.
(The format of our PDB-style files is described here.)

Timeline for d5c3pb1:

  • d5c3pb1 first appeared in SCOPe 2.05, called d5c3pb_