Lineage for d5aurg_ (5aur G:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2690798Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2690913Protein Cytochrome c552 [46636] (6 species)
  7. 2690914Species Hydrogenobacter thermophilus [TaxId:940] [46640] (9 PDB entries)
  8. 2690919Domain d5aurg_: 5aur G: [278297]
    automated match to d1ynra_
    complexed with hec, iod

Details for d5aurg_

PDB Entry: 5aur (more details), 1.26 Å

PDB Description: hydrogenobacter thermophilus cytochrome c552 dimer formed by domain swapping at n-terminal region
PDB Compounds: (G:) Cytochrome c-552

SCOPe Domain Sequences for d5aurg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5aurg_ a.3.1.1 (G:) Cytochrome c552 {Hydrogenobacter thermophilus [TaxId: 940]}
neqlakqkgcmachdlkagggkkvgpayadvakkyagrkdavdylagkikkggsgvwgsv
pmppqnvtdaeakqlaqwilsik

SCOPe Domain Coordinates for d5aurg_:

Click to download the PDB-style file with coordinates for d5aurg_.
(The format of our PDB-style files is described here.)

Timeline for d5aurg_: