Lineage for d5al8b_ (5al8 B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2378393Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2378753Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 2378754Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
    automatically mapped to Pfam PF00576
  6. 2378755Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
    sandwich; 8 strands in 2 sheets
  7. 2378776Species Human (Homo sapiens) [TaxId:9606] [49475] (320 PDB entries)
    Uniprot P02766 31-143
  8. 2379112Domain d5al8b_: 5al8 B: [278283]
    automated match to d1f41a_
    complexed with d75

Details for d5al8b_

PDB Entry: 5al8 (more details), 1.5 Å

PDB Description: transthyretin binding heterogeneity and anti-amyloidogenic activity of natural polyphenols and their metabolites: daidzein-7-o- glucuronide
PDB Compounds: (B:) Transthyretin

SCOPe Domain Sequences for d5al8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5al8b_ b.3.4.1 (B:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn

SCOPe Domain Coordinates for d5al8b_:

Click to download the PDB-style file with coordinates for d5al8b_.
(The format of our PDB-style files is described here.)

Timeline for d5al8b_: