SCOPe 2.05: Domain d4zylb_: 4zyl B:

Lineage for d4zylb_ (4zyl B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (59 species)
   not a true protein

7. Species Rhodopseudomonas palustris [TaxId:258594] [278269] (1 PDB entry)

8. Domain d4zylb_: 4zyl B: [278270]
   automated match to d3heba_

Details for d4zylb_

PDB Entry: 4zyl, 1.8 Å

PDB Description: crystal structure of response regulator rpa3017 in red light signaling of r. palustris

PDB Compounds: (B:) RphyB protein

SCOPe Domain Sequences for d4zylb_:

Sequence; same for both SEQRES and ATOM records:

>d4zylb_ c.23.1.0 (B:) automated matches {Rhodopseudomonas palustris [TaxId: 258594]}
tlptvlvaedhdydkliltevfarasisadlrfvsdgeqtldyiygrnrfadrgdapypa
ivlldlnmprldgrkvvrllrqdetvrhlvvialstsesakhiteaysigfnaylvkpan
iadyveairslwhfwmntaslptt

Timeline for d4zylb_:

• d4zylb_ is new in SCOPe 2.05-stable
  
• d4zylb_ appears in SCOPe 2.06
  
• d4zylb_ appears in the current release, SCOPe 2.08