Lineage for d1g0ea_ (1g0e A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.74: Carbonic anhydrase [51068] (1 superfamily) Superfamily b.74.1: Carbonic anhydrase [51069] (1 family) 
Family b.74.1.1: Carbonic anhydrase [51070] (1 protein) Protein Carbonic anhydrase [51071] (8 species) Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (128 PDB entries) 
Domain d1g0ea_: 1g0e A: [27825]
Details for d1g0ea_
PDB Entry: 1g0e (more details), 1.6 Å
PDB Description: site-specific mutant (his64 replaced with ala) of human carbonic anhydrase ii complexed with 4-methylimidazole
SCOP Domain Sequences for d1g0ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g0ea_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II}
hhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnn
gaafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvh
wntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprg
llpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvd
nwrpaqplknrqikasfk
SCOP Domain Coordinates for d1g0ea_:
Click to download the PDB-style file with coordinates for d1g0ea_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1g0ea_:
- d1g0ea_ appears in SCOP 1.57
- d1g0ea_ appears in the current release, SCOPe 2.08
View in 3D