Lineage for d4z65a_ (4z65 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1860688Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 1861985Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 1861986Family c.56.5.1: Pancreatic carboxypeptidases [53188] (5 proteins)
  6. 1862075Protein automated matches [190397] (2 species)
    not a true protein
  7. 1862080Species Pig (Sus scrofa) [TaxId:9823] [187266] (22 PDB entries)
  8. 1862087Domain d4z65a_: 4z65 A: [278239]
    automated match to d2pj1b_
    complexed with 0x9, zn

Details for d4z65a_

PDB Entry: 4z65 (more details), 1.25 Å

PDB Description: carboxypeptidase b with sulphamoil arginine
PDB Compounds: (A:) carboxypeptidase b

SCOPe Domain Sequences for d4z65a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z65a_ c.56.5.1 (A:) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
ghsyekynnwetieawtkqvtsenpdlisrtaigttflgnniyllkvgkpgpnkpaifmd
cgfharewishafcqwfvreavltygyeshmteflnkldfyvlpvlnidgyiytwtknrm
wrktrstnagttcigtdpnrnfdagwcttgastdpcdetycgsaaeseketkaladfirn
nlssikayltihsysqmilypysydyklpennaelnnlakaavkelatlygtkytygpga
ttiypaaggsddwaydqgikysftfelrdkgrygfilpesqiqatceetmlaikyvtnyv
lghl

SCOPe Domain Coordinates for d4z65a_:

Click to download the PDB-style file with coordinates for d4z65a_.
(The format of our PDB-style files is described here.)

Timeline for d4z65a_: