Lineage for d4yv5b_ (4yv5 B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1750246Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 1750247Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 1750252Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 1750608Protein automated matches [190139] (25 species)
    not a true protein
  7. 1750618Species Bothrops moojeni [TaxId:98334] [188126] (4 PDB entries)
  8. 1750624Domain d4yv5b_: 4yv5 B: [278230]
    automated match to d4kf3a_
    complexed with 1pe, pe4, so4, svr

Details for d4yv5b_

PDB Entry: 4yv5 (more details), 1.9 Å

PDB Description: crystal structure of myotoxin ii from bothrops moojeni complexed to suramin
PDB Compounds: (B:) Basic phospholipase A2 homolog 2

SCOPe Domain Sequences for d4yv5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yv5b_ a.133.1.2 (B:) automated matches {Bothrops moojeni [TaxId: 98334]}
slfelgkmilqetgknpaksygvygcncgvggrgkpkdatdrccyvhkccykkltgcdpk
kdrysyswkdktivcgennsclkelcecdkavaiclrenldtynkkyrynylkpfckkad
pc

SCOPe Domain Coordinates for d4yv5b_:

Click to download the PDB-style file with coordinates for d4yv5b_.
(The format of our PDB-style files is described here.)

Timeline for d4yv5b_: