| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) ![]() |
| Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) automatically mapped to Pfam PF00068 |
| Protein automated matches [190139] (27 species) not a true protein |
| Species Bothrops moojeni [TaxId:98334] [188126] (13 PDB entries) |
| Domain d4yv5b_: 4yv5 B: [278230] automated match to d4kf3a_ complexed with 1pe, pe4, so4, svr |
PDB Entry: 4yv5 (more details), 1.9 Å
SCOPe Domain Sequences for d4yv5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yv5b_ a.133.1.2 (B:) automated matches {Bothrops moojeni [TaxId: 98334]}
slfelgkmilqetgknpaksygvygcncgvggrgkpkdatdrccyvhkccykkltgcdpk
kdrysyswkdktivcgennsclkelcecdkavaiclrenldtynkkyrynylkpfckkad
pc
Timeline for d4yv5b_: