SCOPe 2.05: Domain d4yp7c_: 4yp7 C:

Lineage for d4yp7c_ (4yp7 C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)

6. Protein Nicotinamide mononucleotide (NMN) adenylyltransferase [52400] (8 species)

7. Species Methanothermobacter thermautotrophicus [TaxId:187420] [278213] (2 PDB entries)

8. Domain d4yp7c_: 4yp7 C: [278219]
   automated match to d1m8ka_
   complexed with nap

Details for d4yp7c_

PDB Entry: 4yp7, 2.3 Å

PDB Description: crystal structure of methanobacterium thermoautotrophicum nmnat in complex with nadp

PDB Compounds: (C:) Nicotinamide-nucleotide Adenylyltransferase

SCOPe Domain Sequences for d4yp7c_:

Sequence; same for both SEQRES and ATOM records:

>d4yp7c_ c.26.1.3 (C:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Methanothermobacter thermautotrophicus [TaxId: 187420]}
tmrgllvgrmqpfhrghlqviksileevdeliicigsaqlshsiedpftagervmmltka
lsengipasryyiipvqdiecnalwvghikmltppfdrvysgnplvqrlfsedgyevtap
plfyrdrysgtevrrrmlddgdwrsllpesvvevideingverikhl

Timeline for d4yp7c_:

• d4yp7c_ is new in SCOPe 2.05-stable
  
• d4yp7c_ is called d4yp7c1 in SCOPe 2.06
  
• d4yp7c_ appears in the current release, SCOPe 2.08, called d4yp7c1