Lineage for d4yp5b1 (4yp5 B:4-171)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2442470Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2442471Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2442769Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)
  6. 2442798Protein Nicotinamide mononucleotide (NMN) adenylyltransferase [52400] (8 species)
  7. 2442872Species Methanothermobacter thermautotrophicus [TaxId:187420] [278213] (3 PDB entries)
  8. 2442877Domain d4yp5b1: 4yp5 B:4-171 [278210]
    Other proteins in same PDB: d4yp5a2, d4yp5b2, d4yp5c2
    automated match to d1m8ka_
    complexed with nap

Details for d4yp5b1

PDB Entry: 4yp5 (more details), 2.21 Å

PDB Description: crystal structure of methanobacterium thermoautotrophicum nmnat in complex with nadp
PDB Compounds: (B:) Nicotinamide-nucleotide Adenylyltransferase

SCOPe Domain Sequences for d4yp5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yp5b1 c.26.1.3 (B:4-171) Nicotinamide mononucleotide (NMN) adenylyltransferase {Methanothermobacter thermautotrophicus [TaxId: 187420]}
mrgllvgrmqpfhrghlqviksileevdeliicigsaqlshsirdpftagervmmltkal
sengipasryyiipvqdiecnalwvghikmltppfdrvysgnplvqrlfsedgyevtapp
lfyrdrysgtevrrrmlddgdwrsllpesvvevideingverikhlak

SCOPe Domain Coordinates for d4yp5b1:

Click to download the PDB-style file with coordinates for d4yp5b1.
(The format of our PDB-style files is described here.)

Timeline for d4yp5b1: