SCOPe 2.08: Domain d4xuwa_: 4xuw A:

Lineage for d4xuwa_ (4xuw A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
   4 helices; folded leaf; right-handed superhelix

4. Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families)
   can be classified as disulfide-rich

5. Family a.52.1.1: Plant lipid-transfer and hydrophobic proteins [47700] (4 proteins)

6. Protein automated matches [190480] (4 species)
   not a true protein

7. Species Corylus avellana [TaxId:13451] [278206] (1 PDB entry)

8. Domain d4xuwa_: 4xuw A: [278208]
   automated match to d1t12a_
   complexed with po4

Details for d4xuwa_

PDB Entry: 4xuw, 1.1 Å

PDB Description: structure of the hazelnut allergen, cor a 8

PDB Compounds: (A:) Non-specific lipid-transfer protein

SCOPe Domain Sequences for d4xuwa_:

Sequence; same for both SEQRES and ATOM records:

>d4xuwa_ a.52.1.1 (A:) automated matches {Corylus avellana [TaxId: 13451]}
sltcpqikgnltpcvlylknggvlppscckgvravndasrttsdrqsacnclkdtakgia
glnpnlaaglpgkcgvnipykispstncnnvk

Timeline for d4xuwa_:

• d4xuwa_ first appeared in SCOPe 2.05
  
• d4xuwa_ appears in SCOPe 2.07