SCOP 1.65: Domain d1huh__: 1huh -

Lineage for d1huh__ (1huh -)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (1 family)

5. Family b.74.1.1: Carbonic anhydrase [51070] (1 protein)

6. Protein Carbonic anhydrase [51071] (9 species)

7. Species Human (Homo sapiens), erythrocytes, isozyme I [TaxId:9606] [51072] (9 PDB entries)

8. Domain d1huh__: 1huh - [27820]
   complexed with iod, zn

Details for d1huh__

PDB Entry: 1huh, 2.2 Å

PDB Description: differences in anionic inhibition of human carbonic anhydrase i revealed from the structures of iodide and gold cyanide inhibitor complexes

SCOP Domain Sequences for d1huh__:

Sequence; same for both SEQRES and ATOM records:

>d1huh__ b.74.1.1 (-) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme I}
dwgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeiinvg
hsfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhvahw
nsakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfdpst
llpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavpmqh
nnrptqplkgrtvrasf

Timeline for d1huh__:

• d1huh__ first appeared (with stable ids) in SCOP 1.55
  
• d1huh__ appears in SCOP 1.63
  
• d1huh__ appears in SCOP 1.67
  
• d1huh__ appears in the current release, SCOPe 2.08, called d1huha_