Lineage for d4x2pa1 (4x2p A:3-132)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2948457Species Pseudomonas putida [TaxId:303] [228629] (7 PDB entries)
  8. 2948462Domain d4x2pa1: 4x2p A:3-132 [278194]
    Other proteins in same PDB: d4x2pa2
    automated match to d2mnra2
    complexed with 3py, mg

Details for d4x2pa1

PDB Entry: 4x2p (more details), 1.65 Å

PDB Description: p. putida mandelate racemase in complex with 3-hydroxypyruvate
PDB Compounds: (A:) mandelate racemase

SCOPe Domain Sequences for d4x2pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4x2pa1 d.54.1.0 (A:3-132) automated matches {Pseudomonas putida [TaxId: 303]}
evlitglrtravnvplaypvhtavgtvgtaplvlidlatsagvvghsylfaytpvalksl
kqllddmaamivneplapvsleamlakrfclagytglirmaaagidmaawdalgkvhetp
lvkllganar

SCOPe Domain Coordinates for d4x2pa1:

Click to download the PDB-style file with coordinates for d4x2pa1.
(The format of our PDB-style files is described here.)

Timeline for d4x2pa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4x2pa2