SCOPe 2.08: Domain d4uv7l2: 4uv7 L:113-216

Lineage for d4uv7l2 (4uv7 L:113-216)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4uv7l2: 4uv7 L:113-216 [278190]
   Other proteins in same PDB: d4uv7h_
   automated match to d3aazb2
   complexed with nag

Details for d4uv7l2

PDB Entry: 4uv7, 2.1 Å

PDB Description: the complex structure of extracellular domain of egfr and gc1118a

PDB Compounds: (L:) gc1118a

SCOPe Domain Sequences for d4uv7l2:

Sequence; same for both SEQRES and ATOM records:

>d4uv7l2 b.1.1.0 (L:113-216) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalnsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d4uv7l2:

• d4uv7l2 first appeared in SCOPe 2.05
  
• d4uv7l2 appears in SCOPe 2.07