SCOP 1.75: Domain d1azma_: 1azm A:

Lineage for d1azma_ (1azm A:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (1 family)

5. Family b.74.1.1: Carbonic anhydrase [51070] (1 protein)

6. Protein Carbonic anhydrase [51071] (10 species)

7. Species Human (Homo sapiens), erythrocytes, isozyme I [TaxId:9606] [51072] (15 PDB entries)

8. Domain d1azma_: 1azm A: [27818]
   complexed with azm, zn

Details for d1azma_

PDB Entry: 1azm, 2 Å

PDB Description: drug-protein interactions: structure of sulfonamide drug complexed with human carbonic anhydrase i

PDB Compounds: (A:) carbonic anhydrase I

SCOP Domain Sequences for d1azma_:

Sequence; same for both SEQRES and ATOM records:

>d1azma_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme I [TaxId: 9606]}
pdwgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeiinv
ghsfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhvah
wnsakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfdps
tllpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavpmq
hnnrptqplkgrtvrasf

Timeline for d1azma_:

• d1azma_ first appeared (with stable ids) in SCOP 1.55, called d1azm__
  
• d1azma_ appears in SCOP 1.73
  
• d1azma_ appears in SCOPe 2.01
  
• d1azma_ appears in the current release, SCOPe 2.08