Lineage for d1azm__ (1azm -)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 566493Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 566494Superfamily b.74.1: Carbonic anhydrase [51069] (1 family) (S)
  5. 566495Family b.74.1.1: Carbonic anhydrase [51070] (1 protein)
  6. 566496Protein Carbonic anhydrase [51071] (10 species)
  7. 566502Species Human (Homo sapiens), erythrocytes, isozyme I [TaxId:9606] [51072] (9 PDB entries)
  8. 566508Domain d1azm__: 1azm - [27818]
    complexed with azm, zn

Details for d1azm__

PDB Entry: 1azm (more details), 2 Å

PDB Description: drug-protein interactions: structure of sulfonamide drug complexed with human carbonic anhydrase i

SCOP Domain Sequences for d1azm__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1azm__ b.74.1.1 (-) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme I}
pdwgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeiinv
ghsfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhvah
wnsakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfdps
tllpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavpmq
hnnrptqplkgrtvrasf

SCOP Domain Coordinates for d1azm__:

Click to download the PDB-style file with coordinates for d1azm__.
(The format of our PDB-style files is described here.)

Timeline for d1azm__: