Lineage for d4wmja_ (4wmj A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140243Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 2140244Superfamily c.80.1: SIS domain [53697] (4 families) (S)
  5. 2140302Family c.80.1.2: Phosphoglucose isomerase, PGI [53701] (2 protein domains)
    permutation of the double-SIS domain fold
    automatically mapped to Pfam PF00342
  6. 2140303Protein Phosphoglucose isomerase, PGI [53702] (8 species)
    moonlights as neuroleukin, autocrine motility factor, and differentiation mediator
  7. 2140309Species Colias eurytheme [TaxId:42296] [311110] (1 PDB entry)
  8. 2140310Domain d4wmja_: 4wmj A: [278171]
    automated match to d3hjba_

Details for d4wmja_

PDB Entry: 4wmj (more details), 1.5 Å

PDB Description: colias eurytheme phosphoglucose isomerase. homodimer from 4-5(18) genotype.
PDB Compounds: (A:) Glucose-6-phosphate isomerase

SCOPe Domain Sequences for d4wmja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wmja_ c.80.1.2 (A:) Phosphoglucose isomerase, PGI {Colias eurytheme [TaxId: 42296]}
kvnlkqdpayqklqeyydnnadkinilqlfqqdadrfnkyslriptpndgeilldysknr
iddttfslllnlaksrnvekardamfagekinftedravlhvalrnrqnrpimvngkdvt
pdvnavlahmkefstqvisgawkgytgkpitdvinigiggsdlgplmvtealkpyanhlk
vhfvsnidgthlaevlkrlnpetalfiiasktfttqetitnatsaktwfleaakdpaavs
khfvalstngekvtafgidpknmfgfwdwvggryslwsaiglsislyigfenfeklldga
nfmdnhfctapleknapvilallgvwygnfygaethallpydqylhrfaayfqqgdmesn
gkyvtrsgatvdystgpvvwgepgtngqhafyqlvhqgtrlipcdflapaqthnpianga
hhkillanflaqtealmkgktdaeakaeleksgmapeaiakilphkvfkgnrptnsivvk
kftpftlgaliamyehkiftqgviwdinsfdqwgvelgkqlakaiepelqdgkkitshda
stnglinflkenf

SCOPe Domain Coordinates for d4wmja_:

Click to download the PDB-style file with coordinates for d4wmja_.
(The format of our PDB-style files is described here.)

Timeline for d4wmja_: