Lineage for d1bzma_ (1bzm A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 676371Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 676372Superfamily b.74.1: Carbonic anhydrase [51069] (1 family) (S)
  5. 676373Family b.74.1.1: Carbonic anhydrase [51070] (1 protein)
  6. 676374Protein Carbonic anhydrase [51071] (10 species)
  7. 676380Species Human (Homo sapiens), erythrocytes, isozyme I [TaxId:9606] [51072] (14 PDB entries)
  8. 676392Domain d1bzma_: 1bzm A: [27817]
    complexed with mzm, zn

Details for d1bzma_

PDB Entry: 1bzm (more details), 2 Å

PDB Description: drug-protein interactions: structure of sulfonamide drug complexed with human carbonic anhydrase i
PDB Compounds: (A:) carbonic anhydrase I

SCOP Domain Sequences for d1bzma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bzma_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme I [TaxId: 9606]}
aspdwgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeii
nvghsfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhv
ahwnsakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfd
pstllpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavp
mqhnnrptqplkgrtvrasf

SCOP Domain Coordinates for d1bzma_:

Click to download the PDB-style file with coordinates for d1bzma_.
(The format of our PDB-style files is described here.)

Timeline for d1bzma_: