![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
![]() | Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (6 families) ![]() has a circularly permuted topology |
![]() | Family d.142.2.0: automated matches [227263] (1 protein) not a true family |
![]() | Protein automated matches [227054] (5 species) not a true protein |
![]() | Species Haemophilus influenzae [TaxId:727] [226055] (8 PDB entries) |
![]() | Domain d4ucta_: 4uct A: [278166] automated match to d1taea_ complexed with 5u1, iwh |
PDB Entry: 4uct (more details), 2.1 Å
SCOPe Domain Sequences for d4ucta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ucta_ d.142.2.0 (A:) automated matches {Haemophilus influenzae [TaxId: 727]} mtniqtqldnlrktlrqyeyeyhvldnpsvpdseydrlfhqlkalelehpefltsdsptq rvgakplsgfsqirheipmlsldnafsdaefnafvkriedrlillpkpltfccepkldgl avsilyvngeltqaatrgdgttgeditanirtirnvplqlltdnpparlevrgevfmpha gferlnkyalehnektfanprnaaagslrqldpnitskrplvlnaygigiaegvdlptth yarlqwlksigipvnpeirlcngadevlgfyrdiqnkrsslgydidgtvlkindialqne lgfiskaprwaiaykfpa
Timeline for d4ucta_: