SCOPe 2.07: Domain d1crma_: 1crm A:

Lineage for d1crma_ (1crm A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families)

5. Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
   automatically mapped to Pfam PF00194

6. Protein Carbonic anhydrase [51071] (10 species)

7. Species Human (Homo sapiens), erythrocytes, isozyme I [TaxId:9606] [51072] (18 PDB entries)

8. Domain d1crma_: 1crm A: [27816]
   complexed with cl, h2s, hg

Details for d1crma_

PDB Entry: 1crm, 2 Å

PDB Description: structure and function of carbonic anhydrases

PDB Compounds: (A:) carbonic anhydrase I

SCOPe Domain Sequences for d1crma_:

Sequence; same for both SEQRES and ATOM records:

>d1crma_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme I [TaxId: 9606]}
wgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeiinvgh
sfhvnfednqdrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhvahwn
sakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfdpstl
lpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavpmqhn
nrptqplkgrtvrasf

Timeline for d1crma_:

• d1crma_ first appeared (with stable ids) in SCOP 1.55, called d1crm__
  
• d1crma_ appears in SCOPe 2.06
  
• d1crma_ appears in the current release, SCOPe 2.08