Lineage for d1crm__ (1crm -)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.74: Carbonic anhydrase [51068] (1 superfamily) Superfamily b.74.1: Carbonic anhydrase [51069] (1 family) 
Family b.74.1.1: Carbonic anhydrase [51070] (1 protein) Protein Carbonic anhydrase [51071] (9 species) 
Species Human (Homo sapiens), erythrocytes, isozyme I [TaxId:9606] [51072] (9 PDB entries) 
Domain d1crm__: 1crm - [27816]
Details for d1crm__
PDB Entry: 1crm (more details), 2 Å
PDB Description: structure and function of carbonic anhydrases
SCOP Domain Sequences for d1crm__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1crm__ b.74.1.1 (-) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme I}
wgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeiinvgh
sfhvnfednqdrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhvahwn
sakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfdpstl
lpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavpmqhn
nrptqplkgrtvrasf
SCOP Domain Coordinates for d1crm__:
Click to download the PDB-style file with coordinates for d1crm__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1crm__:
- d1crm__ first appeared (with stable ids) in SCOP 1.55
- d1crm__ appears in SCOP 1.59
- d1crm__ appears in the current release, SCOPe 2.08, called d1crma_
View in 3D