Lineage for d4tx4b_ (4tx4 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2935698Superfamily d.17.1: Cystatin/monellin [54403] (7 families) (S)
    has a additional strand at the N-terminus
  5. 2935875Family d.17.1.0: automated matches [191407] (1 protein)
    not a true family
  6. 2935876Protein automated matches [190558] (13 species)
    not a true protein
  7. 2935895Species Cowpea (Vigna unguiculata) [TaxId:3917] [278150] (1 PDB entry)
  8. 2935897Domain d4tx4b_: 4tx4 B: [278152]
    automated match to d3ul5d_
    complexed with so4

Details for d4tx4b_

PDB Entry: 4tx4 (more details), 1.95 Å

PDB Description: crystal structure of a single-domain cysteine protease inhibitor from cowpea (vigna unguiculata)
PDB Compounds: (B:) Cysteine proteinase inhibitor

SCOPe Domain Sequences for d4tx4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tx4b_ d.17.1.0 (B:) automated matches {Cowpea (Vigna unguiculata) [TaxId: 3917]}
sleidslarfaveehnkkqnallefgrvvsaqqqvvsgtlytitleakdggqkkvyeakv
wekpwlnfkelqefkhvgd

SCOPe Domain Coordinates for d4tx4b_:

Click to download the PDB-style file with coordinates for d4tx4b_.
(The format of our PDB-style files is described here.)

Timeline for d4tx4b_: