SCOPe 2.06: Domain d4tx4a_: 4tx4 A:

Lineage for d4tx4a_ (4tx4 A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.1: Cystatin/monellin [54403] (7 families)
   has a additional strand at the N-terminus

5. Family d.17.1.0: automated matches [191407] (1 protein)
   not a true family

6. Protein automated matches [190558] (10 species)
   not a true protein

7. Species Cowpea (Vigna unguiculata) [TaxId:3917] [278150] (1 PDB entry)

8. Domain d4tx4a_: 4tx4 A: [278151]
   automated match to d3ul5d_
   complexed with so4

Details for d4tx4a_

PDB Entry: 4tx4, 1.95 Å

PDB Description: crystal structure of a single-domain cysteine protease inhibitor from cowpea (vigna unguiculata)

PDB Compounds: (A:) Cysteine proteinase inhibitor

SCOPe Domain Sequences for d4tx4a_:

Sequence; same for both SEQRES and ATOM records:

>d4tx4a_ d.17.1.0 (A:) automated matches {Cowpea (Vigna unguiculata) [TaxId: 3917]}
nsleidslarfaveehnkkqnallefgrvvsaqqqvvsgtlytitleakdggqkkvyeak
vwekpwlnfkelqefkhvgdapa

Timeline for d4tx4a_:

• d4tx4a_ first appeared in SCOPe 2.05
  
• d4tx4a_ appears in SCOPe 2.07
  
• d4tx4a_ appears in the current release, SCOPe 2.08