Lineage for d1hug__ (1hug -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.74: Carbonic anhydrase [51068] (1 superfamily) Superfamily b.74.1: Carbonic anhydrase [51069] (1 family) 
Family b.74.1.1: Carbonic anhydrase [51070] (1 protein) Protein Carbonic anhydrase [51071] (8 species) 
Species Human (Homo sapiens), erythrocytes, isozyme I [TaxId:9606] [51072] (7 PDB entries) 
Domain d1hug__: 1hug - [27815]
Details for d1hug__
PDB Entry: 1hug (more details), 2 Å
PDB Description: differences in anionic inhibition of human carbonic anhydrase i revealed from the structures of iodide and gold cyanide inhibitor complexes
SCOP Domain Sequences for d1hug__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hug__ b.74.1.1 (-) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme I}
wgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeiinvgh
sfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhvahwn
sakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfdpstl
lpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavpmqhn
nrptqplkgrtvrasf
SCOP Domain Coordinates for d1hug__:
Click to download the PDB-style file with coordinates for d1hug__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hug__:
- d1hug__ appears in SCOP 1.57
- d1hug__ appears in the current release, SCOPe 2.08, called d1huga_
View in 3D