![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
![]() | Superfamily d.2.1: Lysozyme-like [53955] (12 families) ![]() |
![]() | Family d.2.1.1: Family 19 glycosidase [53956] (2 proteins) automatically mapped to Pfam PF00182 |
![]() | Protein automated matches [190455] (7 species) not a true protein |
![]() | Species Vigna unguiculata [TaxId:138955] [278148] (1 PDB entry) |
![]() | Domain d4tx7a_: 4tx7 A: [278149] automated match to d3iwrb_ |
PDB Entry: 4tx7 (more details), 1.55 Å
SCOPe Domain Sequences for d4tx7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4tx7a_ d.2.1.1 (A:) automated matches {Vigna unguiculata [TaxId: 138955]} apsdlsalipratfdqmlkhrndgacpargfytydafiaaarafpsfgntgdtatrkrei aaflgqtshettggwpsapdgpyawgycfvreqnpsaycsptpqfpcasgqqyygrgpiq iswnynygqcgnaigvdlinnpdlvatdpvvsfksaiwfwmtpqspkpsshdvitsqwtp saadvaagklpgygtvtniingglecgrgqdsrvedrigffkqycdlfgvgygnnldcys qapfg
Timeline for d4tx7a_: