| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
| Protein automated matches [226839] (64 species) not a true protein |
| Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [226691] (4 PDB entries) |
| Domain d4rwtb1: 4rwt B:7-146 [278146] Other proteins in same PDB: d4rwta2, d4rwtb2, d4rwtc_ automated match to d2btfa1 complexed with anp, mg |
PDB Entry: 4rwt (more details), 2.98 Å
SCOPe Domain Sequences for d4rwtb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rwtb1 c.55.1.0 (B:7-146) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
alvvdngsgmckagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgilt
lkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfet
fntpamyvaiqavlslyasg
Timeline for d4rwtb1: