SCOPe 2.05: Domain d4rwta1: 4rwt A:7-146

Lineage for d4rwta1 (4rwt A:7-146)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (49 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [226691] (3 PDB entries)

8. Domain d4rwta1: 4rwt A:7-146 [278144]
   Other proteins in same PDB: d4rwta2, d4rwtb2, d4rwtc_
   automated match to d2btfa1
   complexed with anp, mg

Details for d4rwta1

PDB Entry: 4rwt, 2.98 Å

PDB Description: structure of actin-lmod complex

PDB Compounds: (A:) Actin-5C

SCOPe Domain Sequences for d4rwta1:

Sequence; same for both SEQRES and ATOM records:

>d4rwta1 c.55.1.0 (A:7-146) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
alvvdngsgmckagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgilt
lkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfet
fntpamyvaiqavlslyasg

Timeline for d4rwta1:

• d4rwta1 is new in SCOPe 2.05-stable
  
• d4rwta1 appears in SCOPe 2.06
  
• d4rwta1 appears in the current release, SCOPe 2.08