Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
Superfamily c.10.1: RNI-like [52047] (4 families) regular structure consisting of similar repeats |
Family c.10.1.0: automated matches [257495] (1 protein) not a true family |
Protein automated matches [257496] (2 species) not a true protein |
Species Homo sapiens [TaxId:9606] [278142] (3 PDB entries) |
Domain d4rwtc_: 4rwt C: [278143] Other proteins in same PDB: d4rwta1, d4rwta2, d4rwtb1, d4rwtb2 automated match to d1io0a_ complexed with anp, mg |
PDB Entry: 4rwt (more details), 2.98 Å
SCOPe Domain Sequences for d4rwtc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rwtc_ c.10.1.0 (C:) automated matches {Homo sapiens [TaxId: 9606]} viedaldkiksndpdttevnlnnienittqtltrfaealkdntvvktfslanthaddsaa maiaemlkvnehitnvnvesnfitgkgilaimralqhntvltelrfhnqrhimgsqveme ivkllkenttllrlgyhfelpgprmsmtsiltrnmdkqrqkrlqeqkq
Timeline for d4rwtc_:
View in 3D Domains from other chains: (mouse over for more information) d4rwta1, d4rwta2, d4rwtb1, d4rwtb2 |