SCOP 1.71: Domain d1hcb__: 1hcb -

Lineage for d1hcb__ (1hcb -)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (1 family)

5. Family b.74.1.1: Carbonic anhydrase [51070] (1 protein)

6. Protein Carbonic anhydrase [51071] (10 species)

7. Species Human (Homo sapiens), erythrocytes, isozyme I [TaxId:9606] [51072] (9 PDB entries)

8. Domain d1hcb__: 1hcb - [27814]
   complexed with bct, zn

Details for d1hcb__

PDB Entry: 1hcb, 1.6 Å

PDB Description: enzyme-substrate interactions: structure of human carbonic anhydrase i complexed with bicarbonate

SCOP Domain Sequences for d1hcb__:

Sequence; same for both SEQRES and ATOM records:

>d1hcb__ b.74.1.1 (-) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme I}
pdwgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeiinv
ghsfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhvah
wnsakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfdps
tllpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavpmq
hnnrptqplkgrtvrasf

Timeline for d1hcb__:

• d1hcb__ first appeared (with stable ids) in SCOP 1.55
  
• d1hcb__ appears in SCOP 1.69
  
• d1hcb__ is called d1hcba_ in SCOP 1.73
  
• d1hcb__ appears in the current release, SCOPe 2.08, called d1hcba_