Lineage for d1hcb__ (1hcb -)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 63199Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
  4. 63200Superfamily b.74.1: Carbonic anhydrase [51069] (1 family) (S)
  5. 63201Family b.74.1.1: Carbonic anhydrase [51070] (1 protein)
  6. 63202Protein Carbonic anhydrase [51071] (9 species)
  7. 63205Species Human (Homo sapiens), erythrocytes, isozyme I [TaxId:9606] [51072] (9 PDB entries)
  8. 63206Domain d1hcb__: 1hcb - [27814]

Details for d1hcb__

PDB Entry: 1hcb (more details), 1.6 Å

PDB Description: enzyme-substrate interactions: structure of human carbonic anhydrase i complexed with bicarbonate

SCOP Domain Sequences for d1hcb__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hcb__ b.74.1.1 (-) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme I}
pdwgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeiinv
ghsfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhvah
wnsakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfdps
tllpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavpmq
hnnrptqplkgrtvrasf

SCOP Domain Coordinates for d1hcb__:

Click to download the PDB-style file with coordinates for d1hcb__.
(The format of our PDB-style files is described here.)

Timeline for d1hcb__: