Lineage for d1hcb__ (1hcb -)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.74: Carbonic anhydrase [51068] (1 superfamily) Superfamily b.74.1: Carbonic anhydrase [51069] (1 family) 
Family b.74.1.1: Carbonic anhydrase [51070] (1 protein) Protein Carbonic anhydrase [51071] (9 species) 
Species Human (Homo sapiens), erythrocytes, isozyme I [TaxId:9606] [51072] (9 PDB entries) 
Domain d1hcb__: 1hcb - [27814]
Details for d1hcb__
PDB Entry: 1hcb (more details), 1.6 Å
PDB Description: enzyme-substrate interactions: structure of human carbonic anhydrase i complexed with bicarbonate
SCOP Domain Sequences for d1hcb__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hcb__ b.74.1.1 (-) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme I}
pdwgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeiinv
ghsfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhvah
wnsakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfdps
tllpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavpmq
hnnrptqplkgrtvrasf
SCOP Domain Coordinates for d1hcb__:
Click to download the PDB-style file with coordinates for d1hcb__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hcb__:
- d1hcb__ first appeared (with stable ids) in SCOP 1.55
- d1hcb__ appears in SCOP 1.59
- d1hcb__ appears in the current release, SCOPe 2.08, called d1hcba_
View in 3D