Lineage for d4p5mg1 (4p5m G:1-83)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2938649Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2938650Protein automated matches [226842] (5 species)
    not a true protein
  7. 2938673Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries)
  8. 2938679Domain d4p5mg1: 4p5m G:1-83 [278138]
    Other proteins in same PDB: d4p5ma2, d4p5mc2, d4p5me2, d4p5mg2
    automated match to d1muja2
    complexed with na, nag

Details for d4p5mg1

PDB Entry: 4p5m (more details), 1.7 Å

PDB Description: structural basis of chronic beryllium disease: bridging the gap between allergic hypersensitivity and autoimmunity
PDB Compounds: (G:) HLA class II histocompatibility antigen, DP alpha 1 chain

SCOPe Domain Sequences for d4p5mg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p5mg1 d.19.1.0 (G:1-83) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ikadhvstyaafvqthrptgefmfefdedemfyvdldkketvwhleefgqafsfeaqggl
aniailnnnlntliqrsnhtqat

SCOPe Domain Coordinates for d4p5mg1:

Click to download the PDB-style file with coordinates for d4p5mg1.
(The format of our PDB-style files is described here.)

Timeline for d4p5mg1: