![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein Hemoglobin, beta-chain [46500] (24 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [46501] (225 PDB entries) Uniprot P68871 |
![]() | Domain d5e29b_: 5e29 B: [278127] Other proteins in same PDB: d5e29a_, d5e29c_ automated match to d1dxub_ complexed with 5jn, cac, hem, no, no3, rq3 |
PDB Entry: 5e29 (more details), 1.85 Å
SCOPe Domain Sequences for d5e29b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5e29b_ a.1.1.2 (B:) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]} hltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkvk ahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgke ftppvqaayqkvvagvanalahkyh
Timeline for d5e29b_: