Lineage for d5do2d2 (5do2 D:108-214)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2752795Domain d5do2d2: 5do2 D:108-214 [278126]
    Other proteins in same PDB: d5do2c_, d5do2d1, d5do2h_, d5do2l1
    automated match to d2v7ha2
    complexed with nag

Details for d5do2d2

PDB Entry: 5do2 (more details), 2.41 Å

PDB Description: complex structure of mers-rbd bound with 4c2 antibody
PDB Compounds: (D:) 4C2 light chain

SCOPe Domain Sequences for d5do2d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5do2d2 b.1.1.2 (D:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOPe Domain Coordinates for d5do2d2:

Click to download the PDB-style file with coordinates for d5do2d2.
(The format of our PDB-style files is described here.)

Timeline for d5do2d2: