SCOPe 2.06: Domain d5do2d1: 5do2 D:1-107

Lineage for d5do2d1 (5do2 D:1-107)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries)

8. Domain d5do2d1: 5do2 D:1-107 [278125]
   Other proteins in same PDB: d5do2d2, d5do2l2
   automated match to d2v7ha1
   complexed with nag

Details for d5do2d1

PDB Entry: 5do2, 2.41 Å

PDB Description: complex structure of mers-rbd bound with 4c2 antibody

PDB Compounds: (D:) 4C2 light chain

SCOPe Domain Sequences for d5do2d1:

Sequence; same for both SEQRES and ATOM records:

>d5do2d1 b.1.1.0 (D:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmtqttsslsaslgdrvtiscrasqdisnylnwyqqkpdgtvklliyytsrlhsgvps
rfsgsgsgtdysltisnleqediatyfcqqgntlprtfgggtkleik

Timeline for d5do2d1:

• d5do2d1 first appeared in SCOPe 2.05
  
• d5do2d1 appears in SCOPe 2.07
  
• d5do2d1 appears in the current release, SCOPe 2.08