Lineage for d1dkga1 (1dkg A:139-197)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 63192Fold b.73: Head domain of nucleotide exchange factor GrpE [51063] (1 superfamily)
  4. 63193Superfamily b.73.1: Head domain of nucleotide exchange factor GrpE [51064] (1 family) (S)
  5. 63194Family b.73.1.1: Head domain of nucleotide exchange factor GrpE [51065] (1 protein)
  6. 63195Protein Head domain of nucleotide exchange factor GrpE [51066] (1 species)
  7. 63196Species Escherichia coli [TaxId:562] [51067] (1 PDB entry)
  8. 63197Domain d1dkga1: 1dkg A:139-197 [27812]
    Other proteins in same PDB: d1dkga2, d1dkgb2, d1dkgd1, d1dkgd2

Details for d1dkga1

PDB Entry: 1dkg (more details), 2.8 Å

PDB Description: crystal structure of the nucleotide exchange factor grpe bound to the atpase domain of the molecular chaperone dnak

SCOP Domain Sequences for d1dkga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dkga1 b.73.1.1 (A:139-197) Head domain of nucleotide exchange factor GrpE {Escherichia coli}
veviaetnvpldpnvhqaiamvesddvapgnvlgimqkgytlngrtiraamvtvakaka

SCOP Domain Coordinates for d1dkga1:

Click to download the PDB-style file with coordinates for d1dkga1.
(The format of our PDB-style files is described here.)

Timeline for d1dkga1: