SCOPe 2.05: Domain d5dwfa_: 5dwf A:

Lineage for d5dwfa_ (5dwf A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families)

5. Family d.118.1.1: N-acetylmuramoyl-L-alanine amidase-like [55847] (11 proteins)
   Family 2 zinc amidase;

6. Protein automated matches [190549] (4 species)
   not a true protein

7. Species Camel (Camelus dromedarius) [TaxId:9838] [188016] (32 PDB entries)

8. Domain d5dwfa_: 5dwf A: [278101]
   automated match to d3ng4a_
   complexed with edo, gol, tla

Details for d5dwfa_

PDB Entry: 5dwf, 1.83 Å

PDB Description: crystal structure of the complex of peptidoglycan recognition protein, pgrp-s from camel with ethylene glycol at 1.83 a resolution

PDB Compounds: (A:) Peptidoglycan recognition protein 1

SCOPe Domain Sequences for d5dwfa_:

Sequence; same for both SEQRES and ATOM records:

>d5dwfa_ d.118.1.1 (A:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
cgsivprrewralasecrerltrpvryvvvshtagshcdtpascaqqaqnvqsyhvrnlg
wcdvgynfligedglvyegrgwnikgahagptwnpisigisfmgnymnrvpppralraaq
nllacgvalgalrsnyevkghrdvqptlspgdrlyeiiqtwshyra

Timeline for d5dwfa_:

• d5dwfa_ is new in SCOPe 2.05-stable
  
• d5dwfa_ appears in SCOPe 2.06
  
• d5dwfa_ appears in the current release, SCOPe 2.08