Lineage for d5dibc1 (5dib C:1-496)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2141090Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2141091Protein automated matches [190683] (49 species)
    not a true protein
  7. 2141664Species Staphylococcus aureus [TaxId:93062] [225575] (13 PDB entries)
  8. 2141700Domain d5dibc1: 5dib C:1-496 [278094]
    automated match to d4qn2a_
    complexed with epe, na, nad; mutant

Details for d5dibc1

PDB Entry: 5dib (more details), 2.25 Å

PDB Description: 2.25 angstrom resolution crystal structure of betaine aldehyde dehydrogenase (betb) y450l point mutant from staphylococcus aureus in complex with nad+ and bme-modified cys289
PDB Compounds: (C:) betaine aldehyde dehydrogenase

SCOPe Domain Sequences for d5dibc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dibc1 c.82.1.0 (C:1-496) automated matches {Staphylococcus aureus [TaxId: 93062]}
mellkhlsqrqyidgewvesankntrdiinpynqeviftvsegtkedaerailaarrafe
sgewsqetaetrgkkvraiadkikehrealarletldtgktleesyadmddihnvfmyfa
gladkdggemidspipdteskivkepvgvvtqitpwnypllqaswkiapalatgcslvmk
pseitplttirvfelmeevgfpkgtinlilgagsevgdvmsghkevdlvsftggietgkh
imknaannvtnialelggknpniifddadfelavdqalnggyfhagqvcsagsrilvqns
ikdkfeqalidrvkkiklgngfdadtemgpvistehrnkiesymdvakaegatiavggkr
pdrddlkdglffeptvitncdtsmrivqeevfgpvvtvegfeteqeaiqlandsiyglag
avfskdigkaqrvanklklgtvwindfhplfaqapwggykqsgigrelgkegleeylvsk
hiltntnpqlvnwfsk

SCOPe Domain Coordinates for d5dibc1:

Click to download the PDB-style file with coordinates for d5dibc1.
(The format of our PDB-style files is described here.)

Timeline for d5dibc1: