Lineage for d5d72l1 (5d72 L:1-108)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2368509Domain d5d72l1: 5d72 L:1-108 [278085]
    Other proteins in same PDB: d5d72a1, d5d72a2, d5d72b1, d5d72b2
    automated match to d3s96d1
    complexed with peg

Details for d5d72l1

PDB Entry: 5d72 (more details), 2.6 Å

PDB Description: crystal structure of mor04252, a neutralizing anti-human gm-csf antibody fab fragment in complex with human gm-csf
PDB Compounds: (L:) Immunglobulin G1 Fab fragment, light chain

SCOPe Domain Sequences for d5d72l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d72l1 b.1.1.0 (L:1-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dieltqppsvsvapgqtariscsgdsigkkyaywyqqkpgqapvlviykkrpsgiperfs
gsnsgntatltisgtqaedeadyycsswdstglvfgggtkltvlgq

SCOPe Domain Coordinates for d5d72l1:

Click to download the PDB-style file with coordinates for d5d72l1.
(The format of our PDB-style files is described here.)

Timeline for d5d72l1: