SCOPe 2.05: Domain d1aiwa_: 1aiw A:

Lineage for d1aiwa_ (1aiw A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.72: WW domain-like [51044] (3 superfamilies)
   core: 3-stranded meander beta-sheet

4. Superfamily b.72.2: Carbohydrate binding domain [51055] (1 family)

5. Family b.72.2.1: Carbohydrate binding domain [51056] (3 proteins)

6. Protein Cellulose-binding domain of endoglucanase Z [51057] (1 species)

7. Species Erwinia chrysanthemi [TaxId:556] [51058] (1 PDB entry)

8. Domain d1aiwa_: 1aiw A: [27808]

Details for d1aiwa_

PDB Entry: 1aiw

PDB Description: nmr structures of the cellulose-binding domain of the endoglucanase z from erwinia chrysanthemi, 23 structures

PDB Compounds: (A:) endoglucanase z

SCOPe Domain Sequences for d1aiwa_:

Sequence; same for both SEQRES and ATOM records:

>d1aiwa_ b.72.2.1 (A:) Cellulose-binding domain of endoglucanase Z {Erwinia chrysanthemi [TaxId: 556]}
mgdcananvypnwvskdwaggqpthneagqsivykgnlytanwytasvpgsdsswtqvgs
cn

Timeline for d1aiwa_:

• d1aiwa_ first appeared (with stable ids) in SCOP 1.55, called d1aiw__
  
• d1aiwa_ appears in SCOPe 2.04
  
• d1aiwa_ appears in SCOPe 2.06
  
• d1aiwa_ appears in the current release, SCOPe 2.08