Lineage for d1aiw__ (1aiw -)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 63149Fold b.72: WW domain-like [51044] (2 superfamilies)
  4. 63172Superfamily b.72.2: Carbohydrate binding domain [51055] (1 family) (S)
  5. 63173Family b.72.2.1: Carbohydrate binding domain [51056] (3 proteins)
  6. 63174Protein Cellulose-binding domain of endoglucanase Z [51057] (1 species)
  7. 63175Species Erwinia chrysanthemi [TaxId:556] [51058] (1 PDB entry)
  8. 63176Domain d1aiw__: 1aiw - [27808]

Details for d1aiw__

PDB Entry: 1aiw (more details)

PDB Description: nmr structures of the cellulose-binding domain of the endoglucanase z from erwinia chrysanthemi, 23 structures

SCOP Domain Sequences for d1aiw__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aiw__ b.72.2.1 (-) Cellulose-binding domain of endoglucanase Z {Erwinia chrysanthemi}
mgdcananvypnwvskdwaggqpthneagqsivykgnlytanwytasvpgsdsswtqvgs
cn

SCOP Domain Coordinates for d1aiw__:

Click to download the PDB-style file with coordinates for d1aiw__.
(The format of our PDB-style files is described here.)

Timeline for d1aiw__: