Lineage for d1aiw__ (1aiw -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.72: WW domain-like [51044] (2 superfamilies) 
Superfamily b.72.2: Carbohydrate binding domain [51055] (1 family) 
Family b.72.2.1: Carbohydrate binding domain [51056] (3 proteins) 
Protein Cellulose-binding domain of endoglucanase Z [51057] (1 species) Species Erwinia chrysanthemi [TaxId:556] [51058] (1 PDB entry) 
Domain d1aiw__: 1aiw - [27808]
Details for d1aiw__
PDB Entry: 1aiw (more details)
PDB Description: nmr structures of the cellulose-binding domain of the endoglucanase z from erwinia chrysanthemi, 23 structures
SCOP Domain Sequences for d1aiw__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aiw__ b.72.2.1 (-) Cellulose-binding domain of endoglucanase Z {Erwinia chrysanthemi}
mgdcananvypnwvskdwaggqpthneagqsivykgnlytanwytasvpgsdsswtqvgs
cn
SCOP Domain Coordinates for d1aiw__:
Click to download the PDB-style file with coordinates for d1aiw__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1aiw__:
- d1aiw__ appears in SCOP 1.57
- d1aiw__ appears in the current release, SCOPe 2.08, called d1aiwa_
View in 3D