Lineage for d1aiwa_ (1aiw A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2811242Fold b.72: WW domain-like [51044] (3 superfamilies)
    core: 3-stranded meander beta-sheet
  4. 2811399Superfamily b.72.2: Carbohydrate binding domain [51055] (1 family) (S)
  5. 2811400Family b.72.2.1: Carbohydrate binding domain [51056] (3 proteins)
  6. 2811401Protein Cellulose-binding domain of endoglucanase Z [51057] (1 species)
  7. 2811402Species Erwinia chrysanthemi [TaxId:556] [51058] (1 PDB entry)
  8. 2811403Domain d1aiwa_: 1aiw A: [27808]

Details for d1aiwa_

PDB Entry: 1aiw (more details)

PDB Description: nmr structures of the cellulose-binding domain of the endoglucanase z from erwinia chrysanthemi, 23 structures
PDB Compounds: (A:) endoglucanase z

SCOPe Domain Sequences for d1aiwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aiwa_ b.72.2.1 (A:) Cellulose-binding domain of endoglucanase Z {Erwinia chrysanthemi [TaxId: 556]}
mgdcananvypnwvskdwaggqpthneagqsivykgnlytanwytasvpgsdsswtqvgs
cn

SCOPe Domain Coordinates for d1aiwa_:

Click to download the PDB-style file with coordinates for d1aiwa_.
(The format of our PDB-style files is described here.)

Timeline for d1aiwa_: