Class a: All alpha proteins [46456] (290 folds) |
Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (4 families) there are two different topoisomers of this fold with different entanglements of the two crossover connections |
Family a.26.1.2: Short-chain cytokines [47286] (14 proteins) |
Protein Granulocyte-macrophage colony-stimulating factor (GM-CSF) [47289] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [47290] (10 PDB entries) |
Domain d5d72a1: 5d72 A:10-110 [278078] Other proteins in same PDB: d5d72a2, d5d72b2, d5d72l1, d5d72l2, d5d72n1, d5d72n2 automated match to d1csga_ complexed with peg |
PDB Entry: 5d72 (more details), 2.6 Å
SCOPe Domain Sequences for d5d72a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5d72a1 a.26.1.2 (A:10-110) Granulocyte-macrophage colony-stimulating factor (GM-CSF) {Human (Homo sapiens) [TaxId: 9606]} tqpwehvnaiqearrllnlsrdtaaemnetvevisemfdlqeptclqtrlelykqglrgs ltklkgpltmmashykqhcpptpetscatqiitfesfkenl
Timeline for d5d72a1: