Lineage for d5d72a1 (5d72 A:10-110)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2705447Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2705448Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2705548Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)
  6. 2705560Protein Granulocyte-macrophage colony-stimulating factor (GM-CSF) [47289] (1 species)
  7. 2705561Species Human (Homo sapiens) [TaxId:9606] [47290] (10 PDB entries)
  8. 2705568Domain d5d72a1: 5d72 A:10-110 [278078]
    Other proteins in same PDB: d5d72a2, d5d72b2, d5d72l1, d5d72l2, d5d72n1, d5d72n2
    automated match to d1csga_
    complexed with peg

Details for d5d72a1

PDB Entry: 5d72 (more details), 2.6 Å

PDB Description: crystal structure of mor04252, a neutralizing anti-human gm-csf antibody fab fragment in complex with human gm-csf
PDB Compounds: (A:) granulocyte-macrophage colony-stimulating factor

SCOPe Domain Sequences for d5d72a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d72a1 a.26.1.2 (A:10-110) Granulocyte-macrophage colony-stimulating factor (GM-CSF) {Human (Homo sapiens) [TaxId: 9606]}
tqpwehvnaiqearrllnlsrdtaaemnetvevisemfdlqeptclqtrlelykqglrgs
ltklkgpltmmashykqhcpptpetscatqiitfesfkenl

SCOPe Domain Coordinates for d5d72a1:

Click to download the PDB-style file with coordinates for d5d72a1.
(The format of our PDB-style files is described here.)

Timeline for d5d72a1: